PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF080800010CFD_t1
Common NameTRAES_3BF080800010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 384aa    MW: 42471 Da    PI: 9.2562
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF080800010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-16107153148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WT+eEd+ll+ +v++ G+++W+ I+++++ gR +kqc++rw ++l
  TRAES3BF080800010CFD_t1 107 KGAWTQEEDKLLKILVARDGNRRWEEISKHLP-GRIGKQCRERWTNHL 153
                              79******************************.************996 PP

2Myb_DNA-binding482.9e-15162202345
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              +WT+eEd +l++ +k lG+  W++Iar++  gR+++++k++w+
  TRAES3BF080800010CFD_t1 162 PWTEEEDRKLIEEHKTLGNS-WSKIARRLF-GRSENSIKNHWY 202
                              8*****************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.752102157IPR017930Myb domain
SMARTSM007171.2E-13106155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-20106160IPR009057Homeodomain-like
SuperFamilySSF466898.99E-28107201IPR009057Homeodomain-like
PfamPF002498.5E-16107153IPR001005SANT/Myb domain
CDDcd001672.11E-14109153No hitNo description
PROSITE profilePS5129417.946158209IPR017930Myb domain
SMARTSM007179.4E-15159207IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-17162202IPR009057Homeodomain-like
PfamPF002491.6E-13162202IPR001005SANT/Myb domain
CDDcd001675.23E-14162205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MASPMDMLFN QEPAAAMTNE AEGRVEGYFP SSSHGFRHFQ QVGTTPIGVP DMGSPISGFR  60
MSPFTFDMPE GPLPVAGYGT GVVPVEIPAV WQKKHSLKNS RAMAPSKGAW TQEEDKLLKI  120
LVARDGNRRW EEISKHLPGR IGKQCRERWT NHLRSDLKNE APWTEEEDRK LIEEHKTLGN  180
SWSKIARRLF GRSENSIKNH WYATKRGLTS KRRFRKRRFS LLEEYIRSTI MGDKSTASPL  240
QSSAPPLGLG SGGQVVPSAS TMLAFSSLPG MGTYLHPGNA PGSSSQGATM NLSSLLPKLN  300
TYGGEMHQRY DSSPSFPPNN MLHYGPPPTF QQMFSQCLQG QDACSNMNLF PLLKSLDLGG  360
NYYCSETGRT SIGGIDDPDD INVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-341072064102MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-341072064102C-Myb DNA-Binding Domain
1msf_C3e-341072064102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A077RXJ20.0A0A077RXJ2_WHEAT; Uncharacterized protein
STRINGMLOC_14401.11e-129(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-39myb domain protein 98
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]